PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g072220.2.1
Common NameLOC101260636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 600aa    MW: 67092.7 Da    PI: 4.5487
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g072220.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.3e-51331592128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         ppGfrFhPtdeelv +yLk+k+ ++++ l ++i e+d+yk+eP+dLp  +k+k+++++w+fFs+rd+ky++g r+nra k+gyWkatgkd+
  Solyc04g072220.2.1  33 PPGFRFHPTDEELVLYYLKRKICRRRILL-DAIGETDVYKWEPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARSNRASKHGYWKATGKDR 122
                         9*************************999.99**************96559999************************************* PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++ ++++vg+kktLvfykgrap ge+tdWvmhey++
  Solyc04g072220.2.1 123 IITC-NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 159
                         ****.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5928182IPR003441NAC domain
PROSITE profilePS5100555.3932182IPR003441NAC domain
PfamPF023655.0E-2733158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MKVLMDSVAA AASSSPCKEV KVSECFGENS VFPPGFRFHP TDEELVLYYL KRKICRRRIL  60
LDAIGETDVY KWEPEDLPDL SKLKTGDRQW FFFSPRDRKY PNGARSNRAS KHGYWKATGK  120
DRIITCNSRA VGVKKTLVFY KGRAPVGERT DWVMHEYTMD EEELKRCQNV QDYYALYKVF  180
KKSGPGPKNG EQYGAPFREE DWLDDERLNA KVSVQPESPR DQENTAKNIN VVPDPDDAIE  240
ELLKRPFTVD NNFALEQFVQ EEDTESTLLN QSSRDVNLYN HCAVAGPSCQ QYNARASFDL  300
TESGTSPLHL HEAPEVSSAP VNPEKPPYAV EEDFLEDFLE MDDLLVVDPN VQNFDHGTPN  360
GQVFDKPAGN LETLQFDDFD GLSEFDLYHD APSLLDNVGT PVVGQIAEPY MNNFVNGITY  420
PDSTTYMSAF QNDMMNNQQM RLNHENQINN QFWMHDERFG VFNPIEGDQS VVDQSSSGVV  480
NDNNMANYPM GANQNLAKKD DGTQSWFSSN LWAFVDSIPT TPASAAESAL VVNRAFERMS  540
SFSRMKLNVG NMNVAAGNAS ATSSSSGKGK YGLCCISLLG VLCAFLWVVI GTSAKIAGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-473218820174NAC domain-containing protein 19
3swm_B1e-473218820174NAC domain-containing protein 19
3swm_C1e-473218820174NAC domain-containing protein 19
3swm_D1e-473218820174NAC domain-containing protein 19
3swp_A1e-473218820174NAC domain-containing protein 19
3swp_B1e-473218820174NAC domain-containing protein 19
3swp_C1e-473218820174NAC domain-containing protein 19
3swp_D1e-473218820174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU3264000.0S.lycopersicum DNA sequence from clone SL_MboI-39E17 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237849.10.0PREDICTED: uncharacterized protein LOC101260636
TrEMBLK4BTK90.0K4BTK9_SOLLC; Uncharacterized protein
STRINGSolyc04g072220.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Representative plantOGRP9932711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-117NAC domain containing protein 17
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]